PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT23519
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 788aa    MW: 87425.4 Da    PI: 4.7783
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT23519genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding223.9e-07639681145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      r +WT+ + +l++++ +q+G++ ++ I + ++  +++ q++ ++ 
         EMT23519 639 RAKWTKSDTDLFYQGLQQFGSD-FAMIQQLFP-DKSRDQVRQKFK 681
                      569*******************.*********.********9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.94E-9631686IPR009057Homeodomain-like
PfamPF159636.0E-24632712No hitNo description
Gene3DG3DSA:1.10.10.604.9E-4636682IPR009057Homeodomain-like
PROSITE profilePS5129310.322637688IPR017884SANT domain
SMARTSM007172.0E-7638686IPR001005SANT/Myb domain
CDDcd001671.89E-5641681No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 788 aa     Download sequence    Send to blast
MIDDEANFDD IIDAPAEVEA AAKFHPNKLR GKLWKKSVPS RSVVPNRTVE TSDEKALALS  60
QDNLSQGLVT NQGIASSAVL GSETIGGAEA CGGTIYTPSD DVLAVSSVDR VSQNDDPHDD  120
PSEVATLQEN LVVSETQASS THPTSKTVDD LADFGELFDT HSEEENVAKS KLKIKVKLSK  180
AASKSRKTGQ KKAASTVDVV SQNKEDGNDD VRGCNDEQAQ APRHEEYVQT SDSQPPLGTD  240
DGTVDNFVNH IRILEEPGPE ETAAKLRPKS QRKPGRASSK AVGTSDDYAA ANLKDINASV  300
DIDSQDGLIN PHTDDTQPIF GEPSAEAAAT FLLDLGKKKG KGKSVTFILP DDYEGVAATD  360
TNHNDIGSDE NLNTLPQQAP QKHCLTEEHS DDQEYTDRES QYYEGERSDH GVEQQSKLDV  420
GKQELSMKLR SRTEIQKVGL SEHIVDDHLD EDFVEPSAAE QNNDSGDENT AGGKQKAPRK  480
SRKKDPNKEP LRGSKRTSTK STSEKSQPNQ QKNKSEVSSR GRKRALKDTM TEQPEKKLTH  540
RIRQKRAQEV QTLLQKPDHE IDRMKLSVTH LRLLQEARER IQSKTPSGPS SSNQSSSRFG  600
DTDDFDPFGD NYDNDRTENQ ALENATKLNY HSYMDKKTRA KWTKSDTDLF YQGLQQFGSD  660
FAMIQQLFPD KSRDQVRQKF KSEDKKHPMQ VHDAILHRSR DNLYLKQVMK QLNIEDSLKD  720
INITQKQEVA PTEGNTGNDV ISETNTFSVE NVSNLSDEEM GTHQSEVKEG EDVAGNADDV  780
DLDVFDWY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3713370.0AK371337.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2131E22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010227475.10.0PREDICTED: uncharacterized protein LOC104581510 isoform X3
TrEMBLM8BNJ20.0M8BNJ2_AEGTA; Transcription factor TFIIIB component B
STRINGMLOC_15633.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25952946
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.12e-27MYB_related family protein